PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G48920.1
Common NameAtMYB45, MYB45, T2J13.240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 261aa    MW: 29875.8 Da    PI: 8.3256
Description myb domain protein 45
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G48920.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.8e-162067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l   v ++G g+W+tI+   g+ R +k+c++rw +yl
      AT3G48920.1 20 KGLWSPEEDEKLRSHVLKYGHGCWSTIPLQAGLQRNGKSCRLRWVNYL 67
                     678*******************************************97 PP

2Myb_DNA-binding45.91.3e-1476117447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +T++E+ +l+ ++ +lG++ W+ I++ ++ gRt++++k++w++ 
      AT3G48920.1  76 FTKQEETILLSLHSMLGNK-WSQISKFLP-GRTDNEIKNYWHSN 117
                      9******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-221470IPR009057Homeodomain-like
PROSITE profilePS5129416.5791567IPR017930Myb domain
SMARTSM007171.4E-111969IPR001005SANT/Myb domain
SuperFamilySSF466895.99E-3019114IPR009057Homeodomain-like
PfamPF002499.4E-142067IPR001005SANT/Myb domain
CDDcd001677.12E-102367No hitNo description
PROSITE profilePS5129423.49368122IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2371121IPR009057Homeodomain-like
SMARTSM007172.6E-1472120IPR001005SANT/Myb domain
CDDcd001673.19E-1076118No hitNo description
PfamPF002492.5E-1376117IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009751Biological Processresponse to salicylic acid
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000084anatomyplant sperm cell
PO:0009031anatomysepal
PO:0020100anatomyhypocotyl
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MVFKSEKSNR EMKSKEKQRK GLWSPEEDEK LRSHVLKYGH GCWSTIPLQA GLQRNGKSCR  60
LRWVNYLRPG LKKSLFTKQE ETILLSLHSM LGNKWSQISK FLPGRTDNEI KNYWHSNLKK  120
GVTLKQHETT KKHQTPLITN SLEALQSSTE RSSSSINVGE TSNAQTSSFS PNLVFSEWLD  180
HSLLMDQSPQ KSSYVQNLVL PEERGFIGPC GPRYLGNDSL PDFVPNSEFL LDDEISSEIE  240
FCTSFSDNFL FDGLINELRP M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-272012227128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible252340_at0.0
Expression AtlasAT3G48920-
AtGenExpressAT3G48920-
ATTED-IIAT3G48920-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G48920.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDsalicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G48920
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195960.0AY519596.1 Arabidopsis thaliana MYB transcription factor (At3g48920) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_190461.10.0myb domain protein 45
SwissprotQ9M0K45e-60LAF1_ARATH; Transcription factor LAF1
TrEMBLQ9SMT10.0Q9SMT1_ARATH; MYB transcription factor
STRINGAT3G48920.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Ma L, et al.
    Genomic evidence for COP1 as a repressor of light-regulated gene expression and development in Arabidopsis.
    Plant Cell, 2002. 14(10): p. 2383-98
    [PMID:12368493]
  4. Nikiforova V, et al.
    Transcriptome analysis of sulfur depletion in Arabidopsis thaliana: interlacing of biosynthetic pathways provides response specificity.
    Plant J., 2003. 33(4): p. 633-50
    [PMID:12609038]
  5. Hoth S, et al.
    Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana.
    FEBS Lett., 2003. 554(3): p. 373-80
    [PMID:14623097]
  6. Contento AL,Kim SJ,Bassham DC
    Transcriptome profiling of the response of Arabidopsis suspension culture cells to Suc starvation.
    Plant Physiol., 2004. 135(4): p. 2330-47
    [PMID:15310832]
  7. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  8. Lee DJ, et al.
    Genome-wide expression profiling of ARABIDOPSIS RESPONSE REGULATOR 7(ARR7) overexpression in cytokinin response.
    Mol. Genet. Genomics, 2007. 277(2): p. 115-37
    [PMID:17061125]
  9. Ramel F, et al.
    Genome-wide interacting effects of sucrose and herbicide-mediated stress in Arabidopsis thaliana: novel insights into atrazine toxicity and sucrose-induced tolerance.
    BMC Genomics, 2007. 8: p. 450
    [PMID:18053238]